PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_9ADA7A031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 220aa    MW: 23096.5 Da    PI: 7.5458
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_9ADA7A031.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY971.3e-30132189158
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                            ldDgy+WrKYG+K vk+s++pr+YYrC+++gC+vkk+ver+++dp +v++tYeg+H h
  Traes_1AL_9ADA7A031.1 132 LDDGYKWRKYGKKAVKNSPNPRNYYRCSTEGCSVKKRVERDRDDPAYVVTTYEGTHSH 189
                            59*******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.5E-33118192IPR003657WRKY domain
SuperFamilySSF1182901.18E-27124192IPR003657WRKY domain
PROSITE profilePS5081131.25127192IPR003657WRKY domain
SMARTSM007743.2E-34132191IPR003657WRKY domain
PfamPF031062.0E-24133189IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MAAVGAAPLL YQQQAQAAGD GCYFSSMSSH FSHGGISSTS SSPASSFSAA LGATPPAAPA  60
IAADPAAQFD ISEYLYDEGT FAAPLPPVVS VPAVGAAAAS SASAVTARSA ESAERPRTER  120
IAFRTRSEVE ILDDGYKWRK YGKKAVKNSP NPRNYYRCST EGCSVKKRVE RDRDDPAYVV  180
TTYEGTHSHV SPSTVYYASQ DAASGRFFVA GTHPPPGSLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-26122193778Probable WRKY transcription factor 4
2lex_A3e-26122193778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8274020.0KR827402.1 Triticum aestivum WRKY51 transcriptional factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654710.13e-83PREDICTED: probable WRKY transcription factor 26
SwissprotQ93WU94e-44WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLW4ZRA91e-159W4ZRA9_WHEAT; Uncharacterized protein
STRINGMLOC_10264.21e-106(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.11e-40WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]